General Information

  • ID:  hor000213
  • Uniprot ID:  P55847
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Penaeus japonicus (Kuruma prawn) (Marsupenaeus japonicus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ
  • Length:  77
  • Propeptide:  MYRLAMRTWLAIVIVVVGTSLLFDTASASFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ
  • Signal peptide:  MYRLAMRTWLAIVIVVVGTSLLFDTASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  1j0t(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1j0t.pdbhor000213_AF2.pdbhor000213_ESM.pdb

Physical Information

Mass: 1042533 Formula: C398H625N115O112S8
Absent amino acids: H Common amino acids: RIN
pI: 8.11 Basic residues: 12
Polar residues: 24 Hydrophobic residues: 27
Hydrophobicity: -20.65 Boman Index: -16214
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 83.51
Instability Index: 3694.42 Extinction Coefficient cystines: 14355
Absorbance 280nm: 188.88

Literature

  • PubMed ID:  8801521
  • Title:  Amino Acid Sequence of a Peptide With Molt-Inhibiting Activity From the Kuruma Prawn Penaeus Japonicus